(data stored in ACNUC7421 zone)

EMBL: CP000271.PE110

CP000271.PE110       Location/Qualifiers
FT   CDS             complement(124439..125155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2917"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2917"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33078"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S61"
FT                   /protein_id="ABE33078.1"
FT                   /translation="MKYAYHLARGACLGSALLFTGNAVAANACNKTPVQPQSVQAIGRD
FT                   MIVNGVPTSVVGMQFSGTTEDVSRAFRDFWIREDVPAKGRTNSSGLLLSALDDHCLYIL
FT                   SIPPQPEGDHTRGLMSVVRLGSDQADHRIPDSAVPLPEESAILSDVESHDPGQTGRTWL
FT                   LDMPGNPQWNAQRYRNSLAAQGWVNVGRQPDYQSTGNRAAQGTAFAMQHGADSVDVSFS
FT                   DHGGRTAAVVNAIRNR"
     MKYAYHLARG ACLGSALLFT GNAVAANACN KTPVQPQSVQ AIGRDMIVNG VPTSVVGMQF        60
     SGTTEDVSRA FRDFWIREDV PAKGRTNSSG LLLSALDDHC LYILSIPPQP EGDHTRGLMS       120
     VVRLGSDQAD HRIPDSAVPL PEESAILSDV ESHDPGQTGR TWLLDMPGNP QWNAQRYRNS       180
     LAAQGWVNVG RQPDYQSTGN RAAQGTAFAM QHGADSVDVS FSDHGGRTAA VVNAIRNR         238
//

If you have problems or comments...

PBIL Back to PBIL home page