(data stored in SCRATCH zone)

EMBL: CP000271.PE111

CP000271.PE111       Location/Qualifiers
FT   CDS             complement(125152..126036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2916"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2916"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33079"
FT                   /db_xref="GOA:Q13S60"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S60"
FT                   /protein_id="ABE33079.1"
FT                   /translation="MKRIDMRNSGQSGQAMVEFLVSMTLVMSVLLLAIAMLGKFNDIRH
FT                   RTLMASRYLAWERTVWSDGDATKNLASDPGTTEGWSGTYGGAALSASKLDTELKREVMQ
FT                   RLMANDGSPISGTDLKQNELPASQPAMWRDYGGNPLLASSSDIAVSTGVAADPASSLNG
FT                   TALSQWAVPTATGGQYLAHLSLPTSTMRSGTLSLSVGGNSDVLKRFWPKDAALPAFSGL
FT                   AFSDTNVLMTNSWMPDGSASNKALFSQAVPAANAVLVPPGGYQGLQKYAPEITSLQFGR
FT                   VQQDVVPANRLKQ"
     MKRIDMRNSG QSGQAMVEFL VSMTLVMSVL LLAIAMLGKF NDIRHRTLMA SRYLAWERTV        60
     WSDGDATKNL ASDPGTTEGW SGTYGGAALS ASKLDTELKR EVMQRLMAND GSPISGTDLK       120
     QNELPASQPA MWRDYGGNPL LASSSDIAVS TGVAADPASS LNGTALSQWA VPTATGGQYL       180
     AHLSLPTSTM RSGTLSLSVG GNSDVLKRFW PKDAALPAFS GLAFSDTNVL MTNSWMPDGS       240
     ASNKALFSQA VPAANAVLVP PGGYQGLQKY APEITSLQFG RVQQDVVPAN RLKQ             294
//

If you have problems or comments...

PBIL Back to PBIL home page