(data stored in ACNUC7421 zone)

EMBL: CP000271.PE112

CP000271.PE112       Location/Qualifiers
FT   CDS             complement(126033..127565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2915"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2915"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33080"
FT                   /db_xref="GOA:Q13S59"
FT                   /db_xref="InterPro:IPR028087"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S59"
FT                   /protein_id="ABE33080.1"
FT                   /translation="MKRSARKGRVRVAGASGQALVPALIFLLAGCIGLYVAFNSFQMTS
FT                   AKIKLQNTADAAAYSAAVLQARDYNFSAYTNRAMIANQVTAAQVVALKSWIDELDATYS
FT                   LSELDEAVDSLADHPAQWSTPKQLGKNDIAPVRAALDALLPTVARNIGSLNRALSVAQA
FT                   NYHAAVITTVPDTADTVAQLNQPDTHVTSGYFTGSRNAAQLAAWTSYTATVIPAGTLGA
FT                   DEFADVVTAPGTLDGFVKNRNSNRSVAPNFQQLTDTAIRICGGANSTFTVNVTHAGGTQ
FT                   LRSDKSGWQSIDASTAQLNVSCLETFGDVAGSGGSANGNITSFMTNPPFAAWQDWQGYG
FT                   GYFNFGYQGSLTPGWQVPEAMAHQFSVGPGPSLDPANGGLLPYQEVNGARPGSEAPRIT
FT                   IEVTRNSDTLVKTIGLQGGGRMAVADNAAGGAMRALSSANAYFVRPDETSIGGSIMGGL
FT                   LNGSQWARADHATEYPSLFSPYWQARLAPVSDEERAAAQASQMSAATQVQKP"
     MKRSARKGRV RVAGASGQAL VPALIFLLAG CIGLYVAFNS FQMTSAKIKL QNTADAAAYS        60
     AAVLQARDYN FSAYTNRAMI ANQVTAAQVV ALKSWIDELD ATYSLSELDE AVDSLADHPA       120
     QWSTPKQLGK NDIAPVRAAL DALLPTVARN IGSLNRALSV AQANYHAAVI TTVPDTADTV       180
     AQLNQPDTHV TSGYFTGSRN AAQLAAWTSY TATVIPAGTL GADEFADVVT APGTLDGFVK       240
     NRNSNRSVAP NFQQLTDTAI RICGGANSTF TVNVTHAGGT QLRSDKSGWQ SIDASTAQLN       300
     VSCLETFGDV AGSGGSANGN ITSFMTNPPF AAWQDWQGYG GYFNFGYQGS LTPGWQVPEA       360
     MAHQFSVGPG PSLDPANGGL LPYQEVNGAR PGSEAPRITI EVTRNSDTLV KTIGLQGGGR       420
     MAVADNAAGG AMRALSSANA YFVRPDETSI GGSIMGGLLN GSQWARADHA TEYPSLFSPY       480
     WQARLAPVSD EERAAAQASQ MSAATQVQKP                                        510
//

If you have problems or comments...

PBIL Back to PBIL home page