(data stored in SCRATCH zone)

EMBL: CP000271.PE114

CP000271.PE114       Location/Qualifiers
FT   CDS             complement(127841..128110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2913"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2913"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33082"
FT                   /db_xref="GOA:Q13S57"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S57"
FT                   /protein_id="ABE33082.1"
FT                   /translation="MRVQTHLPIRGVACGIAPLILINFATLRSQQILILRPTPLPVGFE
FT                   RWVAFFISVQDTRGRKVVSRHYQIVHLTFFQVRDYENFSNPSQK"
     MRVQTHLPIR GVACGIAPLI LINFATLRSQ QILILRPTPL PVGFERWVAF FISVQDTRGR        60
     KVVSRHYQIV HLTFFQVRDY ENFSNPSQK                                          89
//

If you have problems or comments...

PBIL Back to PBIL home page