(data stored in SCRATCH zone)

EMBL: CP000271.PE12

CP000271.PE12        Location/Qualifiers
FT   CDS             13151..13630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B3017"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B3017"
FT                   /db_xref="EnsemblGenomes-Tr:ABE32980"
FT                   /db_xref="InterPro:IPR009783"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SF9"
FT                   /protein_id="ABE32980.1"
FT                   /translation="MTDPIETRPPLPPFTRETAIQKVRAAEDGWNTRDPERVSLAYTKD
FT                   SVWRNRAEFTNGRAEIVGLLRRKWAKELDYRLIKELWAFTDNRIAVRFAYEWHDDSNNW
FT                   FRSYGNENWEFDEHGLMARRHASINDMPIREADRLYHWPLGRRPDDHPGLSDLGL"
     MTDPIETRPP LPPFTRETAI QKVRAAEDGW NTRDPERVSL AYTKDSVWRN RAEFTNGRAE        60
     IVGLLRRKWA KELDYRLIKE LWAFTDNRIA VRFAYEWHDD SNNWFRSYGN ENWEFDEHGL       120
     MARRHASIND MPIREADRLY HWPLGRRPDD HPGLSDLGL                              159
//

If you have problems or comments...

PBIL Back to PBIL home page