(data stored in SCRATCH zone)

EMBL: CP000271.PE122

CP000271.PE122       Location/Qualifiers
FT   CDS             143502..144521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2905"
FT                   /product="Hpt domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2905"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33090"
FT                   /db_xref="GOA:Q13S49"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S49"
FT                   /protein_id="ABE33090.1"
FT                   /translation="MNPVSLSRSSSCTWNQTLGDLLDDSPLESRAFVLDETVTNLREVI
FT                   HGVVALLTPLAHRRDLRLRACVDQSVAETIRTDAARLGQLVFHLLNRTIQLTTHGEISL
FT                   AVRAQPVNLGSQRIYVSVVDTAVKFAPNALPPHPGPAIEDPQMARWLGDANACLPLCRI
FT                   LAQRMGGKLSVSSGTGEGPRAIFDAPFGVEQWAPSAETARGNVQASAFSSAAAQPREIS
FT                   ASDSFEPFDSRYLDALTEEGVDLQVFLNNWRDAMNEDLEQLSGLLREGRFDHLHDVLHR
FT                   LSGAVGLVGASSLMEALRRASTPPEEHSAASVEALLVRAKTLVTQLETTSRAYRSPSQ"
     MNPVSLSRSS SCTWNQTLGD LLDDSPLESR AFVLDETVTN LREVIHGVVA LLTPLAHRRD        60
     LRLRACVDQS VAETIRTDAA RLGQLVFHLL NRTIQLTTHG EISLAVRAQP VNLGSQRIYV       120
     SVVDTAVKFA PNALPPHPGP AIEDPQMARW LGDANACLPL CRILAQRMGG KLSVSSGTGE       180
     GPRAIFDAPF GVEQWAPSAE TARGNVQASA FSSAAAQPRE ISASDSFEPF DSRYLDALTE       240
     EGVDLQVFLN NWRDAMNEDL EQLSGLLREG RFDHLHDVLH RLSGAVGLVG ASSLMEALRR       300
     ASTPPEEHSA ASVEALLVRA KTLVTQLETT SRAYRSPSQ                              339
//

If you have problems or comments...

PBIL Back to PBIL home page