(data stored in ACNUC7421 zone)

EMBL: CP000271.PE123

CP000271.PE123       Location/Qualifiers
FT   CDS             144518..145525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2904"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2904"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33091"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S48"
FT                   /protein_id="ABE33091.1"
FT                   /translation="MNRPLALIEGDLALPIARPFDALPPPFGSRRRPVQTAAQPEPQAR
FT                   SRTAAQQAIQHAVQRREPGARRGPFPPGVKFLLFYKLPQQRDHSRRFDEQLAEARYYLE
FT                   TGRVRPRSTRSDHVLGAAIFAGCGIALAWLLATCTTHNADKAATAIARSAAVRPPAEFA
FT                   GTIAQSEPSAAHSAPKAAVSEAPASANATPGAVFGNVPTPEPQRAEHLVPRPSARVSAD
FT                   QTAPSRPAKANHEPSIARLSKPHVDGRLASSRMTNPATQPSASKSAEWTARSSSANETA
FT                   GRAALFDWAAQQRRAAMTTRAGMPAPGDTDWTARMTQRRITDNPDAFETARSTK"
     MNRPLALIEG DLALPIARPF DALPPPFGSR RRPVQTAAQP EPQARSRTAA QQAIQHAVQR        60
     REPGARRGPF PPGVKFLLFY KLPQQRDHSR RFDEQLAEAR YYLETGRVRP RSTRSDHVLG       120
     AAIFAGCGIA LAWLLATCTT HNADKAATAI ARSAAVRPPA EFAGTIAQSE PSAAHSAPKA       180
     AVSEAPASAN ATPGAVFGNV PTPEPQRAEH LVPRPSARVS ADQTAPSRPA KANHEPSIAR       240
     LSKPHVDGRL ASSRMTNPAT QPSASKSAEW TARSSSANET AGRAALFDWA AQQRRAAMTT       300
     RAGMPAPGDT DWTARMTQRR ITDNPDAFET ARSTK                                  335
//

If you have problems or comments...

PBIL Back to PBIL home page