(data stored in ACNUC7421 zone)

EMBL: CP000271.PE126

CP000271.PE126       Location/Qualifiers
FT   CDS             complement(149871..150377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2901"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2901"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33094"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S45"
FT                   /protein_id="ABE33094.1"
FT                   /translation="MKKLMIAAVIGALSTTMLSVATDAVAQTATTTKPATKAVPKKPQP
FT                   KRLIKRKPNPAKEAKVDPVPEGAEKWSCNEGLAFELKGDMKRDQIVTVHWANKNYNLPR
FT                   EATTTGADRFHDAATGMDLVVIPTKAMLFSDKDSSRLADECKTAAMIEGAPAPTQSNAI
FT                   NKTSN"
     MKKLMIAAVI GALSTTMLSV ATDAVAQTAT TTKPATKAVP KKPQPKRLIK RKPNPAKEAK        60
     VDPVPEGAEK WSCNEGLAFE LKGDMKRDQI VTVHWANKNY NLPREATTTG ADRFHDAATG       120
     MDLVVIPTKA MLFSDKDSSR LADECKTAAM IEGAPAPTQS NAINKTSN                    168
//

If you have problems or comments...

PBIL Back to PBIL home page