(data stored in ACNUC7421 zone)

EMBL: CP000271.PE13

CP000271.PE13        Location/Qualifiers
FT   CDS             13842..14360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B3016"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B3016"
FT                   /db_xref="EnsemblGenomes-Tr:ABE32981"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SF8"
FT                   /protein_id="ABE32981.1"
FT                   /translation="MHFRQINKNIRRAALALVASLAAASAAHAGNWCEGGVWVDAMLGS
FT                   YHINPDPDTHFEQFNPGLGVECWLNNQWALTAGGFRNSLRRPSYYGGGVWAPEFAHWGI
FT                   VRIAAIGGIISGYNYGNWGLGRNHTIGPVVAPIVMVEYKRVGANFIVIPPIPSDDLPFT
FT                   IGFQLKVKF"
     MHFRQINKNI RRAALALVAS LAAASAAHAG NWCEGGVWVD AMLGSYHINP DPDTHFEQFN        60
     PGLGVECWLN NQWALTAGGF RNSLRRPSYY GGGVWAPEFA HWGIVRIAAI GGIISGYNYG       120
     NWGLGRNHTI GPVVAPIVMV EYKRVGANFI VIPPIPSDDL PFTIGFQLKV KF               172
//

If you have problems or comments...

PBIL Back to PBIL home page