(data stored in ACNUC7421 zone)

EMBL: CP000271.PE130

CP000271.PE130       Location/Qualifiers
FT   CDS             complement(154106..154465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2897"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2897"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33098"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S41"
FT                   /protein_id="ABE33098.1"
FT                   /translation="MSNKGLRVFSEAVPCSAATHRQPLCTMLFPRSSGFDFAAIRWPDA
FT                   CRNALFAGARIVQRLPGAVRMCHPAPTRLYRFPAWRSCRNAPLGLGRLRGSPRTVISAV
FT                   FHNASLNAHIEWRFP"
     MSNKGLRVFS EAVPCSAATH RQPLCTMLFP RSSGFDFAAI RWPDACRNAL FAGARIVQRL        60
     PGAVRMCHPA PTRLYRFPAW RSCRNAPLGL GRLRGSPRTV ISAVFHNASL NAHIEWRFP        119
//

If you have problems or comments...

PBIL Back to PBIL home page