(data stored in SCRATCH zone)

EMBL: CP000271.PE132

CP000271.PE132       Location/Qualifiers
FT   CDS             155541..155954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2895"
FT                   /product="succinate dehydrogenase subunit C"
FT                   /EC_number="1.3.5.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2895"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33100"
FT                   /db_xref="GOA:Q13S39"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR014314"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S39"
FT                   /protein_id="ABE33100.1"
FT                   /translation="MAEAVKKPRPEFRNIGIGQILTAYRLPLAGRVSILHRLSGGLLFV
FT                   FLPFLLYLFDQSLTSELSFEVFKGFLSNIIVKLITLVLAWAFLFHFCAGIRHLVMDTHR
FT                   AVTKEGGKQTSVVVLVVSSLLTIAFALKLFGAF"
     MAEAVKKPRP EFRNIGIGQI LTAYRLPLAG RVSILHRLSG GLLFVFLPFL LYLFDQSLTS        60
     ELSFEVFKGF LSNIIVKLIT LVLAWAFLFH FCAGIRHLVM DTHRAVTKEG GKQTSVVVLV       120
     VSSLLTIAFA LKLFGAF                                                      137
//

If you have problems or comments...

PBIL Back to PBIL home page