(data stored in SCRATCH zone)

EMBL: CP000271.PE133

CP000271.PE133       Location/Qualifiers
FT   CDS             155959..156327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2894"
FT                   /product="succinate dehydrogenase subunit D"
FT                   /EC_number="1.3.5.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2894"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33101"
FT                   /db_xref="GOA:Q13S38"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR014312"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S38"
FT                   /protein_id="ABE33101.1"
FT                   /translation="MAANNRIGPKRLVVGAHYGLRDWLAQRITACVMAIYTVILLVWFF
FT                   GARDFSYEGWSSIFATQWMKLATFVTLLSLFYHAWVGIRDIWMDYVKPVGTRLFLQALT
FT                   IVWLLACAGYAAQILWRV"
     MAANNRIGPK RLVVGAHYGL RDWLAQRITA CVMAIYTVIL LVWFFGARDF SYEGWSSIFA        60
     TQWMKLATFV TLLSLFYHAW VGIRDIWMDY VKPVGTRLFL QALTIVWLLA CAGYAAQILW       120
     RV                                                                      122
//

If you have problems or comments...

PBIL Back to PBIL home page