(data stored in ACNUC7421 zone)

EMBL: CP000271.PE134

CP000271.PE134       Location/Qualifiers
FT   CDS             156332..158107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2893"
FT                   /product="succinate dehydrogenase subunit A"
FT                   /EC_number="1.3.5.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2893"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33102"
FT                   /db_xref="GOA:Q13S37"
FT                   /db_xref="InterPro:IPR003952"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR011281"
FT                   /db_xref="InterPro:IPR014006"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S37"
FT                   /protein_id="ABE33102.1"
FT                   /translation="MAAIKNSLPRRKFDVVIVGAGGSGMRASLQLARAGLSVCVLSKVF
FT                   PTRSHTVAAQGGIGASLGNMSEDNWHYHFYDTIKGSDWLGDQDAIEYMCREAPNAVYEL
FT                   EHFGMPFDRNADGTIYQRPFGGHTANYGEKPVQRACAAADRTGHALLHTLYQQNVAAKT
FT                   QFFVEWMALDLIRDAEGDVLGVTALEMETGDVYILEGKTTLFATGGAGRIFAASTNAFI
FT                   NTGDGLGMAARSGIALQDMEFWQFHPTGVAGAGVLITEGVRGEGGILRNSNGERFMERY
FT                   APTLKDLAPRDFVSRSMDQEIKEGRGVGPNKDHVLLDLSHIGAETIMKRLPSIREIALK
FT                   FANVDCIKEPIPVVPTIHYQMGGIPTNIHGQVVGTSKGAEDPVNGFYAVGECSCVSVHG
FT                   ANRLGTNSLLDLVVFGRAAGNHIVKHVKEIKEHKPLPADAADFALSRLAKLDSSSSGEY
FT                   AQSVANDIRGTMQKHAGVFRTSALLAEGVERIREVADRVDNIHLKDKSKVFNTARIEAL
FT                   EVANLIEVARATMVSAEARKESRGAHAQDDFEHRDDENWLRHTLWFSKGDRLDYKPVHM
FT                   QPLTVESVPPKARTF"
     MAAIKNSLPR RKFDVVIVGA GGSGMRASLQ LARAGLSVCV LSKVFPTRSH TVAAQGGIGA        60
     SLGNMSEDNW HYHFYDTIKG SDWLGDQDAI EYMCREAPNA VYELEHFGMP FDRNADGTIY       120
     QRPFGGHTAN YGEKPVQRAC AAADRTGHAL LHTLYQQNVA AKTQFFVEWM ALDLIRDAEG       180
     DVLGVTALEM ETGDVYILEG KTTLFATGGA GRIFAASTNA FINTGDGLGM AARSGIALQD       240
     MEFWQFHPTG VAGAGVLITE GVRGEGGILR NSNGERFMER YAPTLKDLAP RDFVSRSMDQ       300
     EIKEGRGVGP NKDHVLLDLS HIGAETIMKR LPSIREIALK FANVDCIKEP IPVVPTIHYQ       360
     MGGIPTNIHG QVVGTSKGAE DPVNGFYAVG ECSCVSVHGA NRLGTNSLLD LVVFGRAAGN       420
     HIVKHVKEIK EHKPLPADAA DFALSRLAKL DSSSSGEYAQ SVANDIRGTM QKHAGVFRTS       480
     ALLAEGVERI REVADRVDNI HLKDKSKVFN TARIEALEVA NLIEVARATM VSAEARKESR       540
     GAHAQDDFEH RDDENWLRHT LWFSKGDRLD YKPVHMQPLT VESVPPKART F                591
//

If you have problems or comments...

PBIL Back to PBIL home page