(data stored in ACNUC7421 zone)

EMBL: CP000271.PE135

CP000271.PE135       Location/Qualifiers
FT   CDS             158132..158836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2892"
FT                   /product="succinate dehydrogenase subunit B"
FT                   /EC_number="1.3.5.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2892"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33103"
FT                   /db_xref="GOA:Q13S36"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S36"
FT                   /protein_id="ABE33103.1"
FT                   /translation="MAKRTFEIYRYDPDKDAAPRMQTYEIEIDSHERMLLDALLKLKAM
FT                   DETLSFRRSCREGVCGSDAMNINGKNGLACLTNLNDLPQKIVLRPLPGLPVVRDLICDF
FT                   TQFFNQYHSIKPYLINDTPPPEKERLQSPEERDELDGLYECILCASCSTSCPSFWWNPD
FT                   KFVGPAGLLQAYRFIADSRDEATGERLDNLEDPYRLFRCHTIMNCVDVCPKGLNPTKAI
FT                   GKIKELMVRRAV"
     MAKRTFEIYR YDPDKDAAPR MQTYEIEIDS HERMLLDALL KLKAMDETLS FRRSCREGVC        60
     GSDAMNINGK NGLACLTNLN DLPQKIVLRP LPGLPVVRDL ICDFTQFFNQ YHSIKPYLIN       120
     DTPPPEKERL QSPEERDELD GLYECILCAS CSTSCPSFWW NPDKFVGPAG LLQAYRFIAD       180
     SRDEATGERL DNLEDPYRLF RCHTIMNCVD VCPKGLNPTK AIGKIKELMV RRAV             234
//

If you have problems or comments...

PBIL Back to PBIL home page