(data stored in SCRATCH zone)

EMBL: CP000271.PE136

CP000271.PE136       Location/Qualifiers
FT   CDS             158838..159110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2891"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2891"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33104"
FT                   /db_xref="InterPro:IPR005631"
FT                   /db_xref="InterPro:IPR036714"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S35"
FT                   /protein_id="ABE33104.1"
FT                   /translation="MDDTSHQSDPLRRARLRWRARRGLLENDLIFERFFGRYEHDLSDA
FT                   DVGALTRLLELSDNDLMDLLLARKEPEGDLADPDVVRVLELLRNA"
     MDDTSHQSDP LRRARLRWRA RRGLLENDLI FERFFGRYEH DLSDADVGAL TRLLELSDND        60
     LMDLLLARKE PEGDLADPDV VRVLELLRNA                                         90
//

If you have problems or comments...

PBIL Back to PBIL home page