(data stored in ACNUC7421 zone)

EMBL: CP000271.PE138

CP000271.PE138       Location/Qualifiers
FT   CDS             160825..162234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2889"
FT                   /product="3-isopropylmalate dehydratase, large subunit"
FT                   /EC_number="4.2.1.33"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2889"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33106"
FT                   /db_xref="GOA:Q13S33"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004430"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR033941"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S33"
FT                   /protein_id="ABE33106.1"
FT                   /translation="MAQTLYDKLWNTHVVHTEEDGTTILYIDRHLLHEVTSPQAFEGLK
FT                   LAERPVWRISANLAVSDHNVPTTDRSHGIADPISRLQVDTLDSNCDAYGITQFKMNDLR
FT                   QGIVHIIGPEQGATLPGMTIVCGDSHTSTHGAFGALAHGIGTSEVEHVLATQTLLQKKS
FT                   KNMLVKVEGALPRGCTAKDIVLAIIGKIGTAGGTGYAIEFGGSTIRALSMEGRMTVCNM
FT                   AIEAGARAGMVAVDDTTIEYLKGRPFSPEGVEWNHAVEYWKQFKSDDGAQFDRVVELNA
FT                   AEIVPQVTWGTSPEMVTAVDGRVPDPDREKDPVKRDALERALKYMALEPNAPIESIKPD
FT                   KIFIGSCTNARIEDIRAAAYVVKKLGRRVAPNIRLAMVVPGSGLVKAQAEREGLDKVFT
FT                   DAGFEWREPGCSMCLAMNADRLEPGERCASTSNRNFEGRQGAGGRTHLVSPAMAAAAAI
FT                   EGHFVDIRKLG"
     MAQTLYDKLW NTHVVHTEED GTTILYIDRH LLHEVTSPQA FEGLKLAERP VWRISANLAV        60
     SDHNVPTTDR SHGIADPISR LQVDTLDSNC DAYGITQFKM NDLRQGIVHI IGPEQGATLP       120
     GMTIVCGDSH TSTHGAFGAL AHGIGTSEVE HVLATQTLLQ KKSKNMLVKV EGALPRGCTA       180
     KDIVLAIIGK IGTAGGTGYA IEFGGSTIRA LSMEGRMTVC NMAIEAGARA GMVAVDDTTI       240
     EYLKGRPFSP EGVEWNHAVE YWKQFKSDDG AQFDRVVELN AAEIVPQVTW GTSPEMVTAV       300
     DGRVPDPDRE KDPVKRDALE RALKYMALEP NAPIESIKPD KIFIGSCTNA RIEDIRAAAY       360
     VVKKLGRRVA PNIRLAMVVP GSGLVKAQAE REGLDKVFTD AGFEWREPGC SMCLAMNADR       420
     LEPGERCAST SNRNFEGRQG AGGRTHLVSP AMAAAAAIEG HFVDIRKLG                   469
//

If you have problems or comments...

PBIL Back to PBIL home page