(data stored in SCRATCH zone)

EMBL: CP000271.PE139

CP000271.PE139       Location/Qualifiers
FT   CDS             162488..163141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2888"
FT                   /product="3-isopropylmalate dehydratase, small subunit"
FT                   /EC_number="4.2.1.33"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2888"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33107"
FT                   /db_xref="GOA:Q13S32"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR004431"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S32"
FT                   /protein_id="ABE33107.1"
FT                   /translation="MEKFIVHTGVVAPLDRENVDTDAIIPKQFLKSIKRTGFGPNAFDE
FT                   WRYLDHGEPGQDNSQRPLNPDFVLNQPRYQGASVLLARKNFGCGSSREHAPWALEQYGF
FT                   RALIAPSFADIFYNNCFKNGVLPIVLTEQQVDHLFNETYAFNGFKLTVDLEAQVVRTAD
FT                   GGTEYPFEVAAFRKYCLLNGFDDIGLTLRHADKIRQFEAERIAKQPWLAHRIVG"
     MEKFIVHTGV VAPLDRENVD TDAIIPKQFL KSIKRTGFGP NAFDEWRYLD HGEPGQDNSQ        60
     RPLNPDFVLN QPRYQGASVL LARKNFGCGS SREHAPWALE QYGFRALIAP SFADIFYNNC       120
     FKNGVLPIVL TEQQVDHLFN ETYAFNGFKL TVDLEAQVVR TADGGTEYPF EVAAFRKYCL       180
     LNGFDDIGLT LRHADKIRQF EAERIAKQPW LAHRIVG                                217
//

If you have problems or comments...

PBIL Back to PBIL home page