(data stored in ACNUC7421 zone)

EMBL: CP000271.PE143

CP000271.PE143       Location/Qualifiers
FT   CDS             165980..168628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2884"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2884"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33111"
FT                   /db_xref="InterPro:IPR020011"
FT                   /db_xref="InterPro:IPR038440"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S28"
FT                   /protein_id="ABE33111.1"
FT                   /translation="MNLRLSSLRAMFVHRGAGQLMATAALAFALAGAGLGSAVAAPGDA
FT                   ASAPDAAAVSYANGGQVTVRAGQSLNDVAIAVTQSHDRATLARASRALFEANPNAFMSH
FT                   DPSRMRVGAVLTVPVLDASGALAASSAGAASAVSATAATTPASAPGTAVASGPASGVAQ
FT                   VNAAAASAVSAASAAARAATPAAPAVAATASVAAEASSAAPAAVVSSAPLVGSQAAALP
FT                   ASGAHEWAGSIQPSASEPAEGASAPGAATTAGTSAAQPASQPRAQVSSLQQLLALKNRV
FT                   LMELQKHGIGGTPAVTATAPTGVAQPAPGASSAAAAPGHVATPVASTSKDAGMSQTELS
FT                   VAAAVGAALVVLLAALRMGRRKRERVAAAEAVSTEGDSAVSARVTGQQDIASTREEIPV
FT                   HEAPDAADEAAVRNAAALAATEREAAEGEAAAREMAERVAAERDAEIRRAAAREAEEQA
FT                   AERAAEERAAAGRAAEERAAAERVAAEQAAAEHAAEERAAAERAVEEQAAAERAAEQQA
FT                   AAERAAEEQAAAKRATEQQTAAERAAEEQTATERATAEQAATERAAAEHAATQQPASGH
FT                   EATAHATFPTQDPATPQRVWQERDVTSASAEPAQVDPNIAPSAQSDFAPEPLPAPPLDH
FT                   FDDATMAASLAAAAELGAEALPLAPPEPLDEAFPHEEPVHRLQWDDEPAAPQEPLPEPA
FT                   APVHSQPAPTVPTEFPRDAVDAFGSLDMPLPPRVESSADHVHAPASLSTQPMSSQEATA
FT                   KQSAAEHHPDDTPHIADEISAGTAGHAAVAGLGAGLGTGLGAGLGASGFGALKLDFDLE
FT                   LPPGPAEPLPAFTQADLTRIARNKLDLATEYIELGDLSGARALINEVIETNDPATRTEA
FT                   RALLSTLAPLS"
     MNLRLSSLRA MFVHRGAGQL MATAALAFAL AGAGLGSAVA APGDAASAPD AAAVSYANGG        60
     QVTVRAGQSL NDVAIAVTQS HDRATLARAS RALFEANPNA FMSHDPSRMR VGAVLTVPVL       120
     DASGALAASS AGAASAVSAT AATTPASAPG TAVASGPASG VAQVNAAAAS AVSAASAAAR       180
     AATPAAPAVA ATASVAAEAS SAAPAAVVSS APLVGSQAAA LPASGAHEWA GSIQPSASEP       240
     AEGASAPGAA TTAGTSAAQP ASQPRAQVSS LQQLLALKNR VLMELQKHGI GGTPAVTATA       300
     PTGVAQPAPG ASSAAAAPGH VATPVASTSK DAGMSQTELS VAAAVGAALV VLLAALRMGR       360
     RKRERVAAAE AVSTEGDSAV SARVTGQQDI ASTREEIPVH EAPDAADEAA VRNAAALAAT       420
     EREAAEGEAA AREMAERVAA ERDAEIRRAA AREAEEQAAE RAAEERAAAG RAAEERAAAE       480
     RVAAEQAAAE HAAEERAAAE RAVEEQAAAE RAAEQQAAAE RAAEEQAAAK RATEQQTAAE       540
     RAAEEQTATE RATAEQAATE RAAAEHAATQ QPASGHEATA HATFPTQDPA TPQRVWQERD       600
     VTSASAEPAQ VDPNIAPSAQ SDFAPEPLPA PPLDHFDDAT MAASLAAAAE LGAEALPLAP       660
     PEPLDEAFPH EEPVHRLQWD DEPAAPQEPL PEPAAPVHSQ PAPTVPTEFP RDAVDAFGSL       720
     DMPLPPRVES SADHVHAPAS LSTQPMSSQE ATAKQSAAEH HPDDTPHIAD EISAGTAGHA       780
     AVAGLGAGLG TGLGAGLGAS GFGALKLDFD LELPPGPAEP LPAFTQADLT RIARNKLDLA       840
     TEYIELGDLS GARALINEVI ETNDPATRTE ARALLSTLAP LS                          882
//

If you have problems or comments...

PBIL Back to PBIL home page