(data stored in SCRATCH zone)

EMBL: CP000271.PE149

CP000271.PE149       Location/Qualifiers
FT   CDS             173263..174135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2878"
FT                   /product="acetyl-CoA carboxylase carboxyltransferase
FT                   subunit alpha"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2878"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33117"
FT                   /db_xref="GOA:Q13S22"
FT                   /db_xref="InterPro:IPR000438"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="InterPro:IPR041010"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S22"
FT                   /protein_id="ABE33117.1"
FT                   /translation="MSWLDKLLPPKIKQTDPKNRKGIPEGLWIKCPSCEAVLYRNDVEA
FT                   NLHVCPKCDHHMRIGARERLDGLLDPEGRYEIGQEIVPVDALKFKDSRKYPDRLKEAMD
FT                   DTDETDAMVVMGGAIHTLPVVVACFEFSFMGGSMGSVVGERFVRGAQNALEQKVPFICF
FT                   TASGGARMQESLLSLMQMAKTTAMLTKLAEARLPFISVLTDPTMGGVSASFAFLGDVVI
FT                   AEPKALIGFAGPRVIEQTVREKLPEGFQRAEFLLTKGAIDMIVDRRKLREEIAQLMALL
FT                   SHQPADAVA"
     MSWLDKLLPP KIKQTDPKNR KGIPEGLWIK CPSCEAVLYR NDVEANLHVC PKCDHHMRIG        60
     ARERLDGLLD PEGRYEIGQE IVPVDALKFK DSRKYPDRLK EAMDDTDETD AMVVMGGAIH       120
     TLPVVVACFE FSFMGGSMGS VVGERFVRGA QNALEQKVPF ICFTASGGAR MQESLLSLMQ       180
     MAKTTAMLTK LAEARLPFIS VLTDPTMGGV SASFAFLGDV VIAEPKALIG FAGPRVIEQT       240
     VREKLPEGFQ RAEFLLTKGA IDMIVDRRKL REEIAQLMAL LSHQPADAVA                  290
//

If you have problems or comments...

PBIL Back to PBIL home page