(data stored in SCRATCH zone)

EMBL: CP000271.PE15

CP000271.PE15        Location/Qualifiers
FT   CDS             15437..15844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B3014"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B3014"
FT                   /db_xref="EnsemblGenomes-Tr:ABE32983"
FT                   /db_xref="InterPro:IPR036696"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SF6"
FT                   /protein_id="ABE32983.1"
FT                   /translation="MSAKLNEASRRVAENCAQRSHNGTIDFGSVVRALGEAGVESYFTD
FT                   YRRGEHTYYAPSGETHVIALPLPDTAIANAFDADAVNQAVRGAQSGAVKYAEFVSRTLA
FT                   AGCVGYFVWIAGRQVQYFGRRGEIHVERFPQ"
     MSAKLNEASR RVAENCAQRS HNGTIDFGSV VRALGEAGVE SYFTDYRRGE HTYYAPSGET        60
     HVIALPLPDT AIANAFDADA VNQAVRGAQS GAVKYAEFVS RTLAAGCVGY FVWIAGRQVQ       120
     YFGRRGEIHV ERFPQ                                                        135
//

If you have problems or comments...

PBIL Back to PBIL home page