(data stored in SCRATCH zone)

EMBL: CP000271.PE151

CP000271.PE151       Location/Qualifiers
FT   CDS             175771..176709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2876"
FT                   /product="Putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2876"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33119"
FT                   /db_xref="GOA:Q13S20"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S20"
FT                   /protein_id="ABE33119.1"
FT                   /translation="MGIFSFGKKDDAPTRRGANTSSTRAARGERVERRTRRTERTVDAD
FT                   AMLLDPTLPEKQRARRRLVGAIAMVVAAVVILPMVLDSHPKPVTDDISIDIPSRPAPKL
FT                   AKAEEDTQAGVAPDNPTPDAALAASGLAPATAARQGQSAATKPPGADTNAAAPAARPAV
FT                   KPQAPSVAANTTPVAPAAPAKPAKPPVTHNAATAPAPATPAPTAQAPSSDDTNAAAGAD
FT                   ANSGTPASPPGSRFAVQLGAFANDTNARNWAAKLKAAGVPAYTEHRKQADGSTLTLLRA
FT                   GPFADRAAASAAIAKVREAGLMSGANSGAAQ"
     MGIFSFGKKD DAPTRRGANT SSTRAARGER VERRTRRTER TVDADAMLLD PTLPEKQRAR        60
     RRLVGAIAMV VAAVVILPMV LDSHPKPVTD DISIDIPSRP APKLAKAEED TQAGVAPDNP       120
     TPDAALAASG LAPATAARQG QSAATKPPGA DTNAAAPAAR PAVKPQAPSV AANTTPVAPA       180
     APAKPAKPPV THNAATAPAP ATPAPTAQAP SSDDTNAAAG ADANSGTPAS PPGSRFAVQL       240
     GAFANDTNAR NWAAKLKAAG VPAYTEHRKQ ADGSTLTLLR AGPFADRAAA SAAIAKVREA       300
     GLMSGANSGA AQ                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page