(data stored in SCRATCH zone)

EMBL: CP000271.PE152

CP000271.PE152       Location/Qualifiers
FT   CDS             176717..177211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2875"
FT                   /product="Putative bacteriocin production related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2875"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33120"
FT                   /db_xref="GOA:Q13S19"
FT                   /db_xref="InterPro:IPR003825"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S19"
FT                   /protein_id="ABE33120.1"
FT                   /translation="MFTAFDYAVMAVIGLSALRGTWRGFLSEIFGLIGWIAAFFIACRF
FT                   VGYVVPLIPSNWPGGALTQWLLAFALVVIGVVLVASVLNALLSRIVQATGLSGVDRSLG
FT                   LMFGLVRGVILVLILVALAGLTELPQQEFWRNALLRPYAVEGVHVMKPLLPETLAAYVR
FT                   V"
     MFTAFDYAVM AVIGLSALRG TWRGFLSEIF GLIGWIAAFF IACRFVGYVV PLIPSNWPGG        60
     ALTQWLLAFA LVVIGVVLVA SVLNALLSRI VQATGLSGVD RSLGLMFGLV RGVILVLILV       120
     ALAGLTELPQ QEFWRNALLR PYAVEGVHVM KPLLPETLAA YVRV                        164
//

If you have problems or comments...

PBIL Back to PBIL home page