(data stored in SCRATCH zone)

EMBL: CP000271.PE157

CP000271.PE157       Location/Qualifiers
FT   CDS             181921..182727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2870"
FT                   /product="histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2870"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33125"
FT                   /db_xref="GOA:Q13S14"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S14"
FT                   /protein_id="ABE33125.1"
FT                   /translation="MTTSSTGNAGEKPVPSGFAVSGRTALLRAETALFMRDHVLSLVSH
FT                   DLRGPLNAIHSWAYVLERKLDANDPNAQRAVTGIRNGVDQQVKLLETIVDATRAETKSL
FT                   VLAYAPFSLHPLLEETVEEVRSGLGRARGVEVTVDSQLATEQLNGDRERLAAALWLMLM
FT                   FAVETGAEGATVTLVTKADTNAWHASVGYEANGTALDDPALPHVLEAFARKQAREPREA
FT                   KRIAWVLALCKRVAEAHGGSFEQVDATGSDTATLALRVPLSATAAK"
     MTTSSTGNAG EKPVPSGFAV SGRTALLRAE TALFMRDHVL SLVSHDLRGP LNAIHSWAYV        60
     LERKLDANDP NAQRAVTGIR NGVDQQVKLL ETIVDATRAE TKSLVLAYAP FSLHPLLEET       120
     VEEVRSGLGR ARGVEVTVDS QLATEQLNGD RERLAAALWL MLMFAVETGA EGATVTLVTK       180
     ADTNAWHASV GYEANGTALD DPALPHVLEA FARKQAREPR EAKRIAWVLA LCKRVAEAHG       240
     GSFEQVDATG SDTATLALRV PLSATAAK                                          268
//

If you have problems or comments...

PBIL Back to PBIL home page