(data stored in ACNUC7421 zone)

EMBL: CP000271.PE159

CP000271.PE159       Location/Qualifiers
FT   CDS             184266..184988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2868"
FT                   /product="Putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2868"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33127"
FT                   /db_xref="GOA:Q13S12"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S12"
FT                   /protein_id="ABE33127.1"
FT                   /translation="MGYLLVLCVGLLAGMLSGVVGTGSSMMLMPVLVMLFGPQEAVPIM
FT                   AIAAIMGNFGKVLAWWREIDWRACGAYCVTAVPGAALGVRTLLALPPHAVEIALGLFFV
FT                   AMVPTRRWLARRAIKFSLWQLSLIGGVVGFLTGIVVSTGPITVPVFMSYGLVKGAFLAT
FT                   EAAGSLTVYASKVAVFNHFGALPLHVVIDGLITGSALMVGSFAARAIVVRMSPATFKLV
FT                   VDGLMLSSGLSLLWAAGR"
     MGYLLVLCVG LLAGMLSGVV GTGSSMMLMP VLVMLFGPQE AVPIMAIAAI MGNFGKVLAW        60
     WREIDWRACG AYCVTAVPGA ALGVRTLLAL PPHAVEIALG LFFVAMVPTR RWLARRAIKF       120
     SLWQLSLIGG VVGFLTGIVV STGPITVPVF MSYGLVKGAF LATEAAGSLT VYASKVAVFN       180
     HFGALPLHVV IDGLITGSAL MVGSFAARAI VVRMSPATFK LVVDGLMLSS GLSLLWAAGR       240
//

If you have problems or comments...

PBIL Back to PBIL home page