(data stored in ACNUC7421 zone)

EMBL: CP000271.PE163

CP000271.PE163       Location/Qualifiers
FT   CDS             complement(192302..194521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2864"
FT                   /product="Putative glycogen operon protein GlgX"
FT                   /EC_number="3.2.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2864"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33131"
FT                   /db_xref="GOA:Q13S08"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR011837"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S08"
FT                   /protein_id="ABE33131.1"
FT                   /translation="MSHAMPDRLLPGSPYPLGASWDGLGVNFAVFSANAQKIELCLFDP
FT                   TGRKELRRFTLPECTDEVWHGYLPNAHPGTAYGFRAHGPYQPQHGHRFNPHKLLLDPYA
FT                   RKLVGQFRWSDALFGYRVHSNRADLSIDRRDSAPAMPKCVVIDEAFDWSHDKRPNVPWG
FT                   ETIVYETHVRGASMLRADLRQHERGTFAALASPEFIDHLLKLGVTAVELLPVHAFLNDR
FT                   FLVERGLRNYWGYNSAAFFAPEPSYLSTHRLDEMRIAVRQLHAAGIEVILDVVYNHTCE
FT                   GNEMGPTVSWRGLDNASYYRLIPGDERHHINDTGCGNTVNLPHPRVLQMVMDSLRYWST
FT                   AFNMDGFRFDLGVTLGREQHGFDPGSGFFDALRQDPILSQRKLISEPWDIGPGGYQLGN
FT                   HPPGFGEWNDRFRDTVRRFWRGDAGLRPDLAARLTGSADLFNRRFRKPWASVNFVTSHD
FT                   GFTLADVTAYEQKHNEANREDNNDGHNENCSRNWGVEGESDDPAILATRKRVARSLIAT
FT                   LLMALGTPMVLAGDESLRTQHGNNNAYCQDNELSWLDWARAESPDGRQMTAFVARVIAL
FT                   RKQHPLLRETRFLFGDREVLPGLFDVGWFDERGDPLTIEAWQDPEGRAFTLRRAGPGLN
FT                   GETEVLLMMLNANEKTLRFTPPAPHLEWHVLLDTAEPENAPHRLAVPEIEVAAHGLVML
FT                   AAQPVGEADWQAGWKPGPQHGPRLLTALPPDPGAHAPTNDASPTT"
     MSHAMPDRLL PGSPYPLGAS WDGLGVNFAV FSANAQKIEL CLFDPTGRKE LRRFTLPECT        60
     DEVWHGYLPN AHPGTAYGFR AHGPYQPQHG HRFNPHKLLL DPYARKLVGQ FRWSDALFGY       120
     RVHSNRADLS IDRRDSAPAM PKCVVIDEAF DWSHDKRPNV PWGETIVYET HVRGASMLRA       180
     DLRQHERGTF AALASPEFID HLLKLGVTAV ELLPVHAFLN DRFLVERGLR NYWGYNSAAF       240
     FAPEPSYLST HRLDEMRIAV RQLHAAGIEV ILDVVYNHTC EGNEMGPTVS WRGLDNASYY       300
     RLIPGDERHH INDTGCGNTV NLPHPRVLQM VMDSLRYWST AFNMDGFRFD LGVTLGREQH       360
     GFDPGSGFFD ALRQDPILSQ RKLISEPWDI GPGGYQLGNH PPGFGEWNDR FRDTVRRFWR       420
     GDAGLRPDLA ARLTGSADLF NRRFRKPWAS VNFVTSHDGF TLADVTAYEQ KHNEANREDN       480
     NDGHNENCSR NWGVEGESDD PAILATRKRV ARSLIATLLM ALGTPMVLAG DESLRTQHGN       540
     NNAYCQDNEL SWLDWARAES PDGRQMTAFV ARVIALRKQH PLLRETRFLF GDREVLPGLF       600
     DVGWFDERGD PLTIEAWQDP EGRAFTLRRA GPGLNGETEV LLMMLNANEK TLRFTPPAPH       660
     LEWHVLLDTA EPENAPHRLA VPEIEVAAHG LVMLAAQPVG EADWQAGWKP GPQHGPRLLT       720
     ALPPDPGAHA PTNDASPTT                                                    739
//

If you have problems or comments...

PBIL Back to PBIL home page