(data stored in ACNUC7421 zone)

EMBL: CP000271.PE164

CP000271.PE164       Location/Qualifiers
FT   CDS             complement(194628..196838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2863"
FT                   /product="1,4-alpha-glucan branching enzyme"
FT                   /EC_number="2.4.1.18"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2863"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33132"
FT                   /db_xref="GOA:Q13S07"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006048"
FT                   /db_xref="InterPro:IPR006407"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR037439"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13S07"
FT                   /protein_id="ABE33132.1"
FT                   /translation="MSEHDPAAGLQPLDIDALVEARHPDPFSQLGLHHTDAGPVVRALL
FT                   PNAAHVSVISRADGALLGELEQLRPGLFAGRITSAAPYRLRIDWHGVVQEIEDTYSFGP
FT                   VLGDEPLGRLAGGDPYAVLECLGARPMEVDGVPGVRFAVWAPNARRVSVVGDFNAWDGR
FT                   RHPMRLRHQAGVWELFVPRVGPGTRYKYELLSRDGHPLPLKADPCAMQTEKPPGTASIV
FT                   AHVDEVEQFPWSDHEWIQSRAGKQTARSPISIYEVHAESWLRVAEEGQRGLDWEELAER
FT                   MIPYVKSMGFTHVEFMPIAEHPFGGSWGYQPLGQFAPSARFGKPEQFARFVDKAHEAGL
FT                   GVILDWVPAHFPNDAHGLIDFDGTPLYEHADPREGYHQDWNTMIYNLGRNEVSAFLIAS
FT                   GLAWLKRYHVDGLRVDAVASMLYRDYSRAADQWVPNIYGGRENLESIAFLKRLNHEVGY
FT                   VPGVPGAITIAEESTAWPGVTARVEDGGLGFQFKWNMGWMHDTLHYMEEDPVYRQYHHH
FT                   NMTFGMVYAYSERFVLPLSHDEVVHGKGSLLGKMPGDRWQKFANLRAYFGFMWTHPGKK
FT                   LLFMGGEFGQLAEFNHDASPHWHLLDDSNHHGVQMLVRDLNRLYSDEPALYLLDCEPGG
FT                   FEWLIGDDSGNSVFAYRRTDGAGRELVVVCNMTPVPRLGYRIGMPRGGRWVEVLNTDAG
FT                   VYGGSNMGNGGLIHTDSQSSHGWPHSAALTLPPLATIVLRAD"
     MSEHDPAAGL QPLDIDALVE ARHPDPFSQL GLHHTDAGPV VRALLPNAAH VSVISRADGA        60
     LLGELEQLRP GLFAGRITSA APYRLRIDWH GVVQEIEDTY SFGPVLGDEP LGRLAGGDPY       120
     AVLECLGARP MEVDGVPGVR FAVWAPNARR VSVVGDFNAW DGRRHPMRLR HQAGVWELFV       180
     PRVGPGTRYK YELLSRDGHP LPLKADPCAM QTEKPPGTAS IVAHVDEVEQ FPWSDHEWIQ       240
     SRAGKQTARS PISIYEVHAE SWLRVAEEGQ RGLDWEELAE RMIPYVKSMG FTHVEFMPIA       300
     EHPFGGSWGY QPLGQFAPSA RFGKPEQFAR FVDKAHEAGL GVILDWVPAH FPNDAHGLID       360
     FDGTPLYEHA DPREGYHQDW NTMIYNLGRN EVSAFLIASG LAWLKRYHVD GLRVDAVASM       420
     LYRDYSRAAD QWVPNIYGGR ENLESIAFLK RLNHEVGYVP GVPGAITIAE ESTAWPGVTA       480
     RVEDGGLGFQ FKWNMGWMHD TLHYMEEDPV YRQYHHHNMT FGMVYAYSER FVLPLSHDEV       540
     VHGKGSLLGK MPGDRWQKFA NLRAYFGFMW THPGKKLLFM GGEFGQLAEF NHDASPHWHL       600
     LDDSNHHGVQ MLVRDLNRLY SDEPALYLLD CEPGGFEWLI GDDSGNSVFA YRRTDGAGRE       660
     LVVVCNMTPV PRLGYRIGMP RGGRWVEVLN TDAGVYGGSN MGNGGLIHTD SQSSHGWPHS       720
     AALTLPPLAT IVLRAD                                                       736
//

If you have problems or comments...

PBIL Back to PBIL home page