(data stored in ACNUC7421 zone)

EMBL: CP000271.PE166

CP000271.PE166       Location/Qualifiers
FT   CDS             complement(200292..203732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2861"
FT                   /product="Putative alpha-amylase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2861"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33134"
FT                   /db_xref="GOA:Q13S05"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR021828"
FT                   /db_xref="InterPro:IPR026585"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S05"
FT                   /protein_id="ABE33134.1"
FT                   /translation="MESPNGYAPRIYFFHSLLVGPLDAWPAQFAHAAGLGFDHALIGSL
FT                   FEPGQAGHGQVVGNHARLHPVFEAQQPATEAIRTLANAAAQNGLTLLADLVIDRMAADG
FT                   ALYAEHADWFHPFESEEARLDPRHVHREDNVAYANFNDPGSSAALAGWWTQQLLTLADA
FT                   GVGGFRFDSPHRVPGAVWRQLRDAVRAKHPEVRFLAATPGLAREDLRGLEGAGFDSVFS
FT                   SVRWWDFRSSWMVEEHAALARIGAPIAFPEAPYGTRLAAELSDAHDAAIVERAYRRALF
FT                   ASVAIGTGWMMPMGFEYGITEPMSQTRGDASQFALAAQAKQFDLSERITHVNQVVRNTK
FT                   TLHANGELRPLSGPGAPAAILLRADQPDLRDAREAVLIAINPELGAPLRVDPARFLAGV
FT                   PGNFTRFVPLDAPANASPATLTPFTLAPGAVRLLRAVAEKPIRLAPPIDKANSKRSGRK
FT                   TVLEAINAPRVAIESVTPSVDNGRFAAKRTVGEHAEITAAIFAEGHDKIAAAVIWRAAD
FT                   ETAWHEVPMTPAEPAGLDIWKARIPLERLGRHEFTVIAWRDDFASLVEHIQKKLKAGQT
FT                   VELELDEAAHLFALVLAEVETSEGAVTAPLEHIVKEFTKADAETKLALLLAPTTARAMT
FT                   AARHRPFLSRDPVIYKIDADRTAARFASWYEIFPRSMSDDESRHGTFADVTKKLPRIRD
FT                   MGFDVLYFPPIHPIGVANRKGRNNTLNAQPGDVGSPYAIGGVEGGHTAVHPQLGTLDDF
FT                   KAMLAAAHEHGLEIALDFAVQCSPDHPWLKEHPTWFAWRPDGTLRYAENPPKKYQDIVN
FT                   PDFYAHDAKPDLWLALRDVFLFWIEAGVHIFRIDNPHTKPLPFWEWVIGDIRARYPDTI
FT                   FLAEAFTRPRMMNRLGKIGFSQSYTYFTWRESKRDFIEYMTELTQTGARDSYRPNFFVN
FT                   TPDINPRHLQSQGRTGFLIRAALASTLAGLWGVYSGFELCEAAALPNSEEYLDSEKYQL
FT                   RAWDWNRPGNIVGEISALNRIRRANPALQTHLGLTFLPAHNDNVLFFEKATESRDNVIV
FT                   VAINLDPFNEQGADIELSWETFQKWNLPDHGPLEVTDQMTGARFEWHGRWQHVQLGSGQ
FT                   PFSIWRIAPLGGLPAERPDEADSDYHADAGNPTPTEGAT"
     MESPNGYAPR IYFFHSLLVG PLDAWPAQFA HAAGLGFDHA LIGSLFEPGQ AGHGQVVGNH        60
     ARLHPVFEAQ QPATEAIRTL ANAAAQNGLT LLADLVIDRM AADGALYAEH ADWFHPFESE       120
     EARLDPRHVH REDNVAYANF NDPGSSAALA GWWTQQLLTL ADAGVGGFRF DSPHRVPGAV       180
     WRQLRDAVRA KHPEVRFLAA TPGLAREDLR GLEGAGFDSV FSSVRWWDFR SSWMVEEHAA       240
     LARIGAPIAF PEAPYGTRLA AELSDAHDAA IVERAYRRAL FASVAIGTGW MMPMGFEYGI       300
     TEPMSQTRGD ASQFALAAQA KQFDLSERIT HVNQVVRNTK TLHANGELRP LSGPGAPAAI       360
     LLRADQPDLR DAREAVLIAI NPELGAPLRV DPARFLAGVP GNFTRFVPLD APANASPATL       420
     TPFTLAPGAV RLLRAVAEKP IRLAPPIDKA NSKRSGRKTV LEAINAPRVA IESVTPSVDN       480
     GRFAAKRTVG EHAEITAAIF AEGHDKIAAA VIWRAADETA WHEVPMTPAE PAGLDIWKAR       540
     IPLERLGRHE FTVIAWRDDF ASLVEHIQKK LKAGQTVELE LDEAAHLFAL VLAEVETSEG       600
     AVTAPLEHIV KEFTKADAET KLALLLAPTT ARAMTAARHR PFLSRDPVIY KIDADRTAAR       660
     FASWYEIFPR SMSDDESRHG TFADVTKKLP RIRDMGFDVL YFPPIHPIGV ANRKGRNNTL       720
     NAQPGDVGSP YAIGGVEGGH TAVHPQLGTL DDFKAMLAAA HEHGLEIALD FAVQCSPDHP       780
     WLKEHPTWFA WRPDGTLRYA ENPPKKYQDI VNPDFYAHDA KPDLWLALRD VFLFWIEAGV       840
     HIFRIDNPHT KPLPFWEWVI GDIRARYPDT IFLAEAFTRP RMMNRLGKIG FSQSYTYFTW       900
     RESKRDFIEY MTELTQTGAR DSYRPNFFVN TPDINPRHLQ SQGRTGFLIR AALASTLAGL       960
     WGVYSGFELC EAAALPNSEE YLDSEKYQLR AWDWNRPGNI VGEISALNRI RRANPALQTH      1020
     LGLTFLPAHN DNVLFFEKAT ESRDNVIVVA INLDPFNEQG ADIELSWETF QKWNLPDHGP      1080
     LEVTDQMTGA RFEWHGRWQH VQLGSGQPFS IWRIAPLGGL PAERPDEADS DYHADAGNPT      1140
     PTEGAT                                                                 1146
//

If you have problems or comments...

PBIL Back to PBIL home page