(data stored in ACNUC7421 zone)

EMBL: CP000271.PE167

CP000271.PE167       Location/Qualifiers
FT   CDS             complement(204200..204775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2860"
FT                   /product="Putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2860"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33135"
FT                   /db_xref="GOA:Q13S04"
FT                   /db_xref="InterPro:IPR009781"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S04"
FT                   /protein_id="ABE33135.1"
FT                   /translation="MPGHPRPMVRVLAGWDAAIWSYLAMIWVYMAVADEGSVRESARRD
FT                   DENAGVVLMVICVATIASIAAIVLELASAKGTAGASTVWHYALTGLTMFGAWFLIPTIF
FT                   TQHYARLYYDPDLTETPLLFPDKALQPDYWDFLYFSFTIAVASQTSDVVLRSRSIRRAT
FT                   LAQSVLSFYFNVAVLGLCVNIAAGLLGS"
     MPGHPRPMVR VLAGWDAAIW SYLAMIWVYM AVADEGSVRE SARRDDENAG VVLMVICVAT        60
     IASIAAIVLE LASAKGTAGA STVWHYALTG LTMFGAWFLI PTIFTQHYAR LYYDPDLTET       120
     PLLFPDKALQ PDYWDFLYFS FTIAVASQTS DVVLRSRSIR RATLAQSVLS FYFNVAVLGL       180
     CVNIAAGLLG S                                                            191
//

If you have problems or comments...

PBIL Back to PBIL home page