(data stored in ACNUC7421 zone)

EMBL: CP000271.PE168

CP000271.PE168       Location/Qualifiers
FT   CDS             204865..205407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2859"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2859"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33136"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S03"
FT                   /protein_id="ABE33136.1"
FT                   /translation="MVCERLRCRGFYSCCGRYLSNRQVTGYVFRNALACRFQLKGEWQA
FT                   AVFSPCVPCHAGGFIRMSSARRSPARIEFMRARKTARAAPDQVWGRGIDATRERHHAGT
FT                   VRQVENDSPSGVPMTDVPENNDAHHEVTHPAASLLLSSDSFSAARRAWVPGACAAAAPG
FT                   RANAAGPMAEVVTDSTQ"
     MVCERLRCRG FYSCCGRYLS NRQVTGYVFR NALACRFQLK GEWQAAVFSP CVPCHAGGFI        60
     RMSSARRSPA RIEFMRARKT ARAAPDQVWG RGIDATRERH HAGTVRQVEN DSPSGVPMTD       120
     VPENNDAHHE VTHPAASLLL SSDSFSAARR AWVPGACAAA APGRANAAGP MAEVVTDSTQ       180
//

If you have problems or comments...

PBIL Back to PBIL home page