(data stored in ACNUC7421 zone)

EMBL: CP000271.PE169

CP000271.PE169       Location/Qualifiers
FT   CDS             205707..206465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2858"
FT                   /product="Putative serine/threonine protein phosphatase"
FT                   /EC_number="3.1.3.16"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2858"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33137"
FT                   /db_xref="GOA:Q13S02"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S02"
FT                   /protein_id="ABE33137.1"
FT                   /translation="MPHYHGLMASVLVNPVEHHPANRSGRDFVVGDLHGCVDALRYLLR
FT                   VITFDPARDRLFSVGDLVDRGEHSELALALLDKPWFFAVLGNHEDMLCAVADGRVRRQW
FT                   WYGIGGLWAAQLSDERLQHYAEVLRGLPLARVVGSGKERFNVLHAEFFGTDAELDAGNF
FT                   SAETRQQLLWGRELALGNGDPQRQRGLSLTYCGHTPMRDIKQVGSQVFIDTGAFGPGGK
FT                   LTIVEPLALRRWSISVEEARAEGAAALALP"
     MPHYHGLMAS VLVNPVEHHP ANRSGRDFVV GDLHGCVDAL RYLLRVITFD PARDRLFSVG        60
     DLVDRGEHSE LALALLDKPW FFAVLGNHED MLCAVADGRV RRQWWYGIGG LWAAQLSDER       120
     LQHYAEVLRG LPLARVVGSG KERFNVLHAE FFGTDAELDA GNFSAETRQQ LLWGRELALG       180
     NGDPQRQRGL SLTYCGHTPM RDIKQVGSQV FIDTGAFGPG GKLTIVEPLA LRRWSISVEE       240
     ARAEGAAALA LP                                                           252
//

If you have problems or comments...

PBIL Back to PBIL home page