(data stored in ACNUC7421 zone)

EMBL: CP000271.PE17

CP000271.PE17        Location/Qualifiers
FT   CDS             complement(16579..18354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B3012"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B3012"
FT                   /db_xref="EnsemblGenomes-Tr:ABE32985"
FT                   /db_xref="GOA:Q13SF4"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SF4"
FT                   /protein_id="ABE32985.1"
FT                   /translation="MNVSVRSYLSPTLVLLAFDWPEGGTREDFLGFAIKRTPGFLATDG
FT                   QEREASSWLPNRLTFKGAVPDTQKDAPSNEAPIQKFMWWDARIDEADREKSFTYLVYPV
FT                   IGKPEAPQLLDAQKGECKISLPAHREESIGSWFNRAVVSSQAFARKVAALHLAPHAVPS
FT                   AAQALRLRTWLANDLQEVFALTLDHAQRAASAVYHLTDPLWAIPAFEAFGKKQGKASLA
FT                   IVYDSHKVSQKGKPPAPSPNQPAVDELGDVATFAPRDKTHIMHDKFIVVNNGNGAASPA
FT                   RVLTGSANFTTEGITEQANVLHLFDSPELATLYSDRAKALAGNPTIAATAKLTPGWSDP
FT                   IQIGSAQVRVCFSPEAKDSRLQIDTIVDAIGKAKHSVVFCLFMPTDEPLREACFAAGDK
FT                   GLMMFGLVNHISPKSAEAAEEAEKNGQTVSTTALANMELYHRGRDKRDVIDAEYFSPAT
FT                   VPAGFEPELRLFPGEHAPDYAPVIIHHKFLVIDAEGANPVVYTGSANMSNNSEHFNDEN
FT                   LLEIRDRRIAGMYLAEFLRLYEHYRARALAIRQKKNGDTHERLMLAPDGSWAKKYFIAD
FT                   SPEDKARVALAHGGD"
     MNVSVRSYLS PTLVLLAFDW PEGGTREDFL GFAIKRTPGF LATDGQEREA SSWLPNRLTF        60
     KGAVPDTQKD APSNEAPIQK FMWWDARIDE ADREKSFTYL VYPVIGKPEA PQLLDAQKGE       120
     CKISLPAHRE ESIGSWFNRA VVSSQAFARK VAALHLAPHA VPSAAQALRL RTWLANDLQE       180
     VFALTLDHAQ RAASAVYHLT DPLWAIPAFE AFGKKQGKAS LAIVYDSHKV SQKGKPPAPS       240
     PNQPAVDELG DVATFAPRDK THIMHDKFIV VNNGNGAASP ARVLTGSANF TTEGITEQAN       300
     VLHLFDSPEL ATLYSDRAKA LAGNPTIAAT AKLTPGWSDP IQIGSAQVRV CFSPEAKDSR       360
     LQIDTIVDAI GKAKHSVVFC LFMPTDEPLR EACFAAGDKG LMMFGLVNHI SPKSAEAAEE       420
     AEKNGQTVST TALANMELYH RGRDKRDVID AEYFSPATVP AGFEPELRLF PGEHAPDYAP       480
     VIIHHKFLVI DAEGANPVVY TGSANMSNNS EHFNDENLLE IRDRRIAGMY LAEFLRLYEH       540
     YRARALAIRQ KKNGDTHERL MLAPDGSWAK KYFIADSPED KARVALAHGG D                591
//

If you have problems or comments...

PBIL Back to PBIL home page