(data stored in SCRATCH zone)

EMBL: CP000271.PE170

CP000271.PE170       Location/Qualifiers
FT   CDS             complement(206497..207198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2857"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2857"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33138"
FT                   /db_xref="InterPro:IPR014914"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S01"
FT                   /protein_id="ABE33138.1"
FT                   /translation="MTQPHWQDRWRTTQLDWAPAYRVIPTRFPAVNLFDRVASPEDFDA
FT                   LYALEAMTNDRLRTEVGELDLVPREERRFGPGYGPIMAALTHLNPLGSRFSDGTYGVFY
FT                   CARSRTTAIAETRYHTGKFLEATAEPPMRQQMRLYTVVAQGNVVDIRGDESVDLAVLSP
FT                   DDYLAGQSLGRAIREAGAPGIVYPSVRDDEGECLAAFSTTLLRDCHHAAYLEYNWNGKQ
FT                   VDIVFELNQVG"
     MTQPHWQDRW RTTQLDWAPA YRVIPTRFPA VNLFDRVASP EDFDALYALE AMTNDRLRTE        60
     VGELDLVPRE ERRFGPGYGP IMAALTHLNP LGSRFSDGTY GVFYCARSRT TAIAETRYHT       120
     GKFLEATAEP PMRQQMRLYT VVAQGNVVDI RGDESVDLAV LSPDDYLAGQ SLGRAIREAG       180
     APGIVYPSVR DDEGECLAAF STTLLRDCHH AAYLEYNWNG KQVDIVFELN QVG              233
//

If you have problems or comments...

PBIL Back to PBIL home page