(data stored in SCRATCH zone)

EMBL: CP000271.PE171

CP000271.PE171       Location/Qualifiers
FT   CDS             complement(207195..207632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2856"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2856"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33139"
FT                   /db_xref="InterPro:IPR024467"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S00"
FT                   /protein_id="ABE33139.1"
FT                   /translation="MAHAARATQAEEPIRRPSSAPTLTEMSAAGLRAFFNIARDWNLSA
FT                   EEQIVLLGSPGRSTYFKWKAAPETARLGRDTLERLSLLLGIYKALQILLPQASTADTWI
FT                   KRPNSAPPFGGRRALDRMLAGNISDLVAVRQYLDAMRGGWA"
     MAHAARATQA EEPIRRPSSA PTLTEMSAAG LRAFFNIARD WNLSAEEQIV LLGSPGRSTY        60
     FKWKAAPETA RLGRDTLERL SLLLGIYKAL QILLPQASTA DTWIKRPNSA PPFGGRRALD       120
     RMLAGNISDL VAVRQYLDAM RGGWA                                             145
//

If you have problems or comments...

PBIL Back to PBIL home page