(data stored in SCRATCH zone)

EMBL: CP000271.PE172

CP000271.PE172       Location/Qualifiers
FT   CDS             207719..208393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2855"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2855"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33140"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RZ9"
FT                   /protein_id="ABE33140.1"
FT                   /translation="MTVEDQEKQEMRVRAVAAGAALAVWCMSGAAVAAGYAEVWNPPEE
FT                   TGHTTKQAGKKTGPATTGGTSAVGSKGASKAAPQHMAGAGHAASSVASAHGNKPSAHAS
FT                   VKKVAASGITKSKTQAAGANKTQRKAAVMTQSKKPNAQVVQAKPGQGKVAQANLVPRRT
FT                   AHPPAAKVAAKSDAAKPAASGVNVPALSANPAPSTKVDANPANASSNPATASSGSLPPI
FT                   IH"
     MTVEDQEKQE MRVRAVAAGA ALAVWCMSGA AVAAGYAEVW NPPEETGHTT KQAGKKTGPA        60
     TTGGTSAVGS KGASKAAPQH MAGAGHAASS VASAHGNKPS AHASVKKVAA SGITKSKTQA       120
     AGANKTQRKA AVMTQSKKPN AQVVQAKPGQ GKVAQANLVP RRTAHPPAAK VAAKSDAAKP       180
     AASGVNVPAL SANPAPSTKV DANPANASSN PATASSGSLP PIIH                        224
//

If you have problems or comments...

PBIL Back to PBIL home page