(data stored in ACNUC7421 zone)

EMBL: CP000271.PE174

CP000271.PE174       Location/Qualifiers
FT   CDS             209596..209979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2853"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2853"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33142"
FT                   /db_xref="InterPro:IPR014347"
FT                   /db_xref="InterPro:IPR037479"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RZ7"
FT                   /protein_id="ABE33142.1"
FT                   /translation="MPLTRIALRAGKPVEYRKALTESIQRSLVETFNVPKDDIFMLITE
FT                   HEAGNFVYDNQYLNVERSDDLVIIQITLNNTRTLEQKKTLYKRMADELAESPGLRREDV
FT                   FINLVEVLKENWSFGNGIAQYAL"
     MPLTRIALRA GKPVEYRKAL TESIQRSLVE TFNVPKDDIF MLITEHEAGN FVYDNQYLNV        60
     ERSDDLVIIQ ITLNNTRTLE QKKTLYKRMA DELAESPGLR REDVFINLVE VLKENWSFGN       120
     GIAQYAL                                                                 127
//

If you have problems or comments...

PBIL Back to PBIL home page