(data stored in ACNUC7421 zone)

EMBL: CP000271.PE177

CP000271.PE177       Location/Qualifiers
FT   CDS             complement(212011..212712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2850"
FT                   /product="ABC molybdate transporter, ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2850"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33145"
FT                   /db_xref="GOA:Q13RZ4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RZ4"
FT                   /protein_id="ABE33145.1"
FT                   /translation="MLLAVDIRKTFQSAERRFTLDVAFQATSQRVVLFGPSGAGKSLTL
FT                   QAIAGLLRPDEGTITLHGNALFDSARGIDLKPQARRVAYLFQDFALFPHLNVRQNIGFG
FT                   LQHGWLNPRARISHPQIDYWLDALELKSVAGNHPAQLSGGQKQRVALARALVAQPRLLL
FT                   LDEPFSALDSALRERMRRELSELQTRLDIPMVLITHDPDDVAAFGDQVVQVSNGQVREN
FT                   QPFAGYARSEP"
     MLLAVDIRKT FQSAERRFTL DVAFQATSQR VVLFGPSGAG KSLTLQAIAG LLRPDEGTIT        60
     LHGNALFDSA RGIDLKPQAR RVAYLFQDFA LFPHLNVRQN IGFGLQHGWL NPRARISHPQ       120
     IDYWLDALEL KSVAGNHPAQ LSGGQKQRVA LARALVAQPR LLLLDEPFSA LDSALRERMR       180
     RELSELQTRL DIPMVLITHD PDDVAAFGDQ VVQVSNGQVR ENQPFAGYAR SEP              233
//

If you have problems or comments...

PBIL Back to PBIL home page