(data stored in ACNUC7421 zone)

EMBL: CP000271.PE178

CP000271.PE178       Location/Qualifiers
FT   CDS             complement(212714..213388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2849"
FT                   /product="ABC molybdate transporter, inner membrane
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2849"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33146"
FT                   /db_xref="GOA:Q13RZ3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011867"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RZ3"
FT                   /protein_id="ABE33146.1"
FT                   /translation="MQQAWIPLLLSLKVAGWATALNLVFGVAAGLGLSRWRSGARDVVD
FT                   SLLMLPLVMPPTVLGYYLLVLLGRRGLIGSWLDRFDIQLVFTWQGAVIASTVVAFPLVL
FT                   KSARAAFEAVDPQLEQAARTLGVSETAVFFRVTLPLAARGILAGGLLAFARALGEFGAT
FT                   LMIAGNLPGRTQTLSVAVYSAVQAGDDSTANFLVLVTSVTCVVILLLAGRLVPQHTLLK
FT                   SG"
     MQQAWIPLLL SLKVAGWATA LNLVFGVAAG LGLSRWRSGA RDVVDSLLML PLVMPPTVLG        60
     YYLLVLLGRR GLIGSWLDRF DIQLVFTWQG AVIASTVVAF PLVLKSARAA FEAVDPQLEQ       120
     AARTLGVSET AVFFRVTLPL AARGILAGGL LAFARALGEF GATLMIAGNL PGRTQTLSVA       180
     VYSAVQAGDD STANFLVLVT SVTCVVILLL AGRLVPQHTL LKSG                        224
//

If you have problems or comments...

PBIL Back to PBIL home page