(data stored in ACNUC7421 zone)

EMBL: CP000271.PE179

CP000271.PE179       Location/Qualifiers
FT   CDS             complement(213411..214184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2848"
FT                   /product="ABC molybdate transporter, periplasmic ligand
FT                   binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2848"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33147"
FT                   /db_xref="GOA:Q13RZ2"
FT                   /db_xref="InterPro:IPR005950"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RZ2"
FT                   /protein_id="ABE33147.1"
FT                   /translation="MTLARRLLKQALFVASAVSVAISANARADELVVSAAASLTNAFKA
FT                   VSEVFEQQHPGTKVLLNFGASDVLMQQIVKGAPADVFASADQKAMDKAVAEKVIVPASR
FT                   KDFAANSLVLIVPTDSHFTPTSLNDLASASVKRVAYGDPASVPIGRYAQGALQAAGVWD
FT                   AVSAKAVLASNVRQSLDYVSRGEVDAGFAFSTDAAIMPDKVKVAMNVPTQTPVTYPIAQ
FT                   VEGSRHAADAQAFINFVLSPAGQSVLARYGFKPAH"
     MTLARRLLKQ ALFVASAVSV AISANARADE LVVSAAASLT NAFKAVSEVF EQQHPGTKVL        60
     LNFGASDVLM QQIVKGAPAD VFASADQKAM DKAVAEKVIV PASRKDFAAN SLVLIVPTDS       120
     HFTPTSLNDL ASASVKRVAY GDPASVPIGR YAQGALQAAG VWDAVSAKAV LASNVRQSLD       180
     YVSRGEVDAG FAFSTDAAIM PDKVKVAMNV PTQTPVTYPI AQVEGSRHAA DAQAFINFVL       240
     SPAGQSVLAR YGFKPAH                                                      257
//

If you have problems or comments...

PBIL Back to PBIL home page