(data stored in ACNUC7421 zone)

EMBL: CP000271.PE180

CP000271.PE180       Location/Qualifiers
FT   CDS             complement(214319..215020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2847"
FT                   /product="Putative phosphoesterase, PA-phosphatase related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2847"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33148"
FT                   /db_xref="GOA:Q13RZ1"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RZ1"
FT                   /protein_id="ABE33148.1"
FT                   /translation="MPDLPAHLWYSITNLGGAGLTLPLAFAIALWLAVGYTWRMAAGWL
FT                   ALLGAAIGIVTVTKLAFLGWGVGVRELDFTGVSGHAMLSTAVYPVVLFLMLLPARPAIR
FT                   LIGVLLGLAAGIAVGLSRVVLSAHSPSEAITGCLTGALAALVFVRLAWHAEPGRLSALP
FT                   VAASMMVLALVMHGVHVPTQRWVTHIALKVSGHDRPFIRAKWKAVRDVRPATAPLSQTL
FT                   NTLAPPHSSRA"
     MPDLPAHLWY SITNLGGAGL TLPLAFAIAL WLAVGYTWRM AAGWLALLGA AIGIVTVTKL        60
     AFLGWGVGVR ELDFTGVSGH AMLSTAVYPV VLFLMLLPAR PAIRLIGVLL GLAAGIAVGL       120
     SRVVLSAHSP SEAITGCLTG ALAALVFVRL AWHAEPGRLS ALPVAASMMV LALVMHGVHV       180
     PTQRWVTHIA LKVSGHDRPF IRAKWKAVRD VRPATAPLSQ TLNTLAPPHS SRA              233
//

If you have problems or comments...

PBIL Back to PBIL home page