(data stored in SCRATCH zone)

EMBL: CP000271.PE184

CP000271.PE184       Location/Qualifiers
FT   CDS             complement(218830..219249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2843"
FT                   /product="Organic hydroperoxide resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2843"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33152"
FT                   /db_xref="GOA:Q13RY7"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR019953"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RY7"
FT                   /protein_id="ABE33152.1"
FT                   /translation="MNILYKASATSTGGRDGRAVSSDNALDVKLAAPRELGGTGAAGTN
FT                   PEQLFAAGYSACFLSAMKFVAGQHKQTLPADTQVTAEVGIGPNDKGGFALDIDLRVSLP
FT                   GLDANAARELVDAAHQVCPYSNATRNNVAVRLQIA"
     MNILYKASAT STGGRDGRAV SSDNALDVKL AAPRELGGTG AAGTNPEQLF AAGYSACFLS        60
     AMKFVAGQHK QTLPADTQVT AEVGIGPNDK GGFALDIDLR VSLPGLDANA ARELVDAAHQ       120
     VCPYSNATRN NVAVRLQIA                                                    139
//

If you have problems or comments...

PBIL Back to PBIL home page