(data stored in ACNUC7421 zone)

EMBL: CP000271.PE186

CP000271.PE186       Location/Qualifiers
FT   CDS             complement(220049..220855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2841"
FT                   /product="Putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2841"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33154"
FT                   /db_xref="GOA:Q13RY5"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RY5"
FT                   /protein_id="ABE33154.1"
FT                   /translation="MQLIEVPAKAGYVWFRQGIWLFRKNPLAFLTLFFTYLLVMTLVSQ
FT                   IPVIGGVLPLAFIPGVAVGFMAACRNTIAGKPVFPTILVDGFHSYGPVVAKRLLVLGVL
FT                   YVVAMALVLAGSALADGGMLLKVMLGGATMDQDAIANSNIPLAVLTALALYIPVAMIFW
FT                   FSPILTAWHDVPPVKAMFFSIVSCWRNRGAFVVFGALWFAVAITVSLGLSALMQALGAG
FT                   DFAFAVLMPATMIVTTMLYCSFYATYRGCFGVQTPETPDLPTTPAA"
     MQLIEVPAKA GYVWFRQGIW LFRKNPLAFL TLFFTYLLVM TLVSQIPVIG GVLPLAFIPG        60
     VAVGFMAACR NTIAGKPVFP TILVDGFHSY GPVVAKRLLV LGVLYVVAMA LVLAGSALAD       120
     GGMLLKVMLG GATMDQDAIA NSNIPLAVLT ALALYIPVAM IFWFSPILTA WHDVPPVKAM       180
     FFSIVSCWRN RGAFVVFGAL WFAVAITVSL GLSALMQALG AGDFAFAVLM PATMIVTTML       240
     YCSFYATYRG CFGVQTPETP DLPTTPAA                                          268
//

If you have problems or comments...

PBIL Back to PBIL home page