(data stored in ACNUC7421 zone)

EMBL: CP000271.PE187

CP000271.PE187       Location/Qualifiers
FT   CDS             complement(220846..221841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2840"
FT                   /product="homoserine kinase"
FT                   /EC_number="2.7.1.39"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2840"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33155"
FT                   /db_xref="GOA:Q13RY4"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR005280"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13RY4"
FT                   /protein_id="ABE33155.1"
FT                   /translation="MAVFTAVTEPQLAEWMRHYDLGDVVEFRGISSGIENSNFFLTTTR
FT                   GEYVLTIFEKLTAEQLPFYLDLMRHLAAHRVPVPDPMPREDGALFGLLQGKPAAIVTRL
FT                   EGAPELAPGVEHCIEVGQMLARMHLAGRDYPAYQPNLRSLPWWKETVPTILPFLEGGQR
FT                   ELLSSELAYQEAFFASADYAALPEGPCHADLFRDNAMFAHAEPGTGHEVRLGGFFDFYF
FT                   AGCDKWLFDVAVTVNDWCVDLATGKLDAARTEAMLRAYQTVRPFTAEENRHWGDMLRAG
FT                   AYRFWVSRLYDFHLPRAAELLKPHDPGHFERILRERLSGVALPGIHTSCN"
     MAVFTAVTEP QLAEWMRHYD LGDVVEFRGI SSGIENSNFF LTTTRGEYVL TIFEKLTAEQ        60
     LPFYLDLMRH LAAHRVPVPD PMPREDGALF GLLQGKPAAI VTRLEGAPEL APGVEHCIEV       120
     GQMLARMHLA GRDYPAYQPN LRSLPWWKET VPTILPFLEG GQRELLSSEL AYQEAFFASA       180
     DYAALPEGPC HADLFRDNAM FAHAEPGTGH EVRLGGFFDF YFAGCDKWLF DVAVTVNDWC       240
     VDLATGKLDA ARTEAMLRAY QTVRPFTAEE NRHWGDMLRA GAYRFWVSRL YDFHLPRAAE       300
     LLKPHDPGHF ERILRERLSG VALPGIHTSC N                                      331
//

If you have problems or comments...

PBIL Back to PBIL home page