(data stored in ACNUC7421 zone)

EMBL: CP000271.PE188

CP000271.PE188       Location/Qualifiers
FT   CDS             complement(222067..222462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2839"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2839"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33156"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RY3"
FT                   /protein_id="ABE33156.1"
FT                   /translation="MKPLLPVAVALALAFGNAAMAAQPVDDTPPPGAPQSANERAGLPD
FT                   LEKINRPAAEVSSKVEINVPRTPSFYERSPNGTEITEYRDKGKPVEINVHSNLGTRYQM
FT                   SAPLDTSPTVRDNGRASTRLPSVHLTY"
     MKPLLPVAVA LALAFGNAAM AAQPVDDTPP PGAPQSANER AGLPDLEKIN RPAAEVSSKV        60
     EINVPRTPSF YERSPNGTEI TEYRDKGKPV EINVHSNLGT RYQMSAPLDT SPTVRDNGRA       120
     STRLPSVHLT Y                                                            131
//

If you have problems or comments...

PBIL Back to PBIL home page