(data stored in SCRATCH zone)

EMBL: CP000271.PE192

CP000271.PE192       Location/Qualifiers
FT   CDS             complement(225695..226438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2835"
FT                   /product="Conserved hypothetical protein 730"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2835"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33160"
FT                   /db_xref="GOA:Q13RX9"
FT                   /db_xref="InterPro:IPR005269"
FT                   /db_xref="InterPro:IPR031100"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RX9"
FT                   /protein_id="ABE33160.1"
FT                   /translation="MTKRKVIPSLRSLADQERATAKKARASWQMFTIMAEFIEATEYLS
FT                   EIRPAVSIYGSARLKPNSPYYKLATQIARKLSDAGFAVISGGGPGIMEAANKGAHAGKA
FT                   PSVGLNIELPHEQSGNQWQDISLRFRHFFTRKVTFVKNSDAVIVMPGGFGTLDELAEVL
FT                   TLIQTKKSRHVPIILVGAEFWEGLLAWFRNSLTPMGLINPADMDLMQVIDDPDQVLEAV
FT                   LKFYEDREEAEPQPTKSDEDRMFYL"
     MTKRKVIPSL RSLADQERAT AKKARASWQM FTIMAEFIEA TEYLSEIRPA VSIYGSARLK        60
     PNSPYYKLAT QIARKLSDAG FAVISGGGPG IMEAANKGAH AGKAPSVGLN IELPHEQSGN       120
     QWQDISLRFR HFFTRKVTFV KNSDAVIVMP GGFGTLDELA EVLTLIQTKK SRHVPIILVG       180
     AEFWEGLLAW FRNSLTPMGL INPADMDLMQ VIDDPDQVLE AVLKFYEDRE EAEPQPTKSD       240
     EDRMFYL                                                                 247
//

If you have problems or comments...

PBIL Back to PBIL home page