(data stored in SCRATCH zone)

EMBL: CP000271.PE197

CP000271.PE197       Location/Qualifiers
FT   CDS             complement(233024..234130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2830"
FT                   /product="Putative osmotic adaptation-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2830"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33165"
FT                   /db_xref="GOA:Q13RX4"
FT                   /db_xref="InterPro:IPR015879"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RX4"
FT                   /protein_id="ABE33165.1"
FT                   /translation="MSNLSNALQLRSVHSQLPVTAYFDEALLTREIDTLFKKGPRYIGH
FT                   DLMVPEAGNYFALPSESEGRVLVRNQQSQVELLSNVCRHRQAIMLNGRGQTENIVCPLH
FT                   RWTYDLNGQLLGAPHFADNPCLNLGATPLQNWQGLLFEAQGRNVARDLARLGTKEHFDF
FT                   SGFMFDHVEVHECNYNWKTFIEVYLEDYHVAPFHPGLGSFVNCDDLTWEFGDWYSVQTV
FT                   GVHKDLEQPGSPTYRKWHDEVLRFRGGNPPDFGAIWMVYYPGIMIEWYPHVLVVSWLIP
FT                   RGPQKTTNVVEFYYPEEIALFEREFVEAERAAYMETAREDDEIAERMDAGRRALMNRGE
FT                   SQVGPYQSPMEDGMQHFHEFLRRELGTI"
     MSNLSNALQL RSVHSQLPVT AYFDEALLTR EIDTLFKKGP RYIGHDLMVP EAGNYFALPS        60
     ESEGRVLVRN QQSQVELLSN VCRHRQAIML NGRGQTENIV CPLHRWTYDL NGQLLGAPHF       120
     ADNPCLNLGA TPLQNWQGLL FEAQGRNVAR DLARLGTKEH FDFSGFMFDH VEVHECNYNW       180
     KTFIEVYLED YHVAPFHPGL GSFVNCDDLT WEFGDWYSVQ TVGVHKDLEQ PGSPTYRKWH       240
     DEVLRFRGGN PPDFGAIWMV YYPGIMIEWY PHVLVVSWLI PRGPQKTTNV VEFYYPEEIA       300
     LFEREFVEAE RAAYMETARE DDEIAERMDA GRRALMNRGE SQVGPYQSPM EDGMQHFHEF       360
     LRRELGTI                                                                368
//

If you have problems or comments...

PBIL Back to PBIL home page