(data stored in SCRATCH zone)

EMBL: CP000271.PE198

CP000271.PE198       Location/Qualifiers
FT   CDS             234415..234723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2829"
FT                   /product="Exodeoxyribonuclease VII small subunit"
FT                   /EC_number="3.1.11.6"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2829"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33166"
FT                   /db_xref="GOA:Q13RX3"
FT                   /db_xref="InterPro:IPR003761"
FT                   /db_xref="InterPro:IPR037004"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RX3"
FT                   /protein_id="ABE33166.1"
FT                   /translation="MAKTASKDTAATPAEGVDTTPLPENYEAAQAELEGLVARMESGNL
FT                   SLEESLTAYRRGAALVAFCQQQLEKVEQQVRVLDGETLKPLPMNTAGTAATESGDDL"
     MAKTASKDTA ATPAEGVDTT PLPENYEAAQ AELEGLVARM ESGNLSLEES LTAYRRGAAL        60
     VAFCQQQLEK VEQQVRVLDG ETLKPLPMNT AGTAATESGD DL                          102
//

If you have problems or comments...

PBIL Back to PBIL home page