(data stored in ACNUC7421 zone)

EMBL: CP000271.PE2

CP000271.PE2         Location/Qualifiers
FT   CDS             1134..2192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B3027"
FT                   /product="ParB family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B3027"
FT                   /db_xref="EnsemblGenomes-Tr:ABE32970"
FT                   /db_xref="GOA:Q13SG9"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SG9"
FT                   /protein_id="ABE32970.1"
FT                   /translation="MKPSQFAKGFQARPDSTSSEKRTALDRLNAIDGIVKNDARHSEAA
FT                   GRVIAPGTPSQSLTEVDAVDAANESAAYRTWRLEHGYRPGQVIELALKTIKPSPFNPRH
FT                   FYLKSSIAELAVNLAKQGQQQAIHVIPDYDNPGTYFVSDGGRRVRALKEANKESVKAIV
FT                   VDLPIGIQSYKLGYDLNVQRDSQTVFDNAVVWRRFLDDRHFQSQKELAEHLGLDESTVA
FT                   VALSISKLPEVVMHEMVARPDRFGSNMAYQVGRYHTARGADATLRLINKILSDDLSTRQ
FT                   VADIVKGRASAQESTKPAGRQRYAQRLEIKLDGVSVGDLKSYGDDRIELRLKGLTREKR
FT                   DDILRQIEKMLK"
     MKPSQFAKGF QARPDSTSSE KRTALDRLNA IDGIVKNDAR HSEAAGRVIA PGTPSQSLTE        60
     VDAVDAANES AAYRTWRLEH GYRPGQVIEL ALKTIKPSPF NPRHFYLKSS IAELAVNLAK       120
     QGQQQAIHVI PDYDNPGTYF VSDGGRRVRA LKEANKESVK AIVVDLPIGI QSYKLGYDLN       180
     VQRDSQTVFD NAVVWRRFLD DRHFQSQKEL AEHLGLDEST VAVALSISKL PEVVMHEMVA       240
     RPDRFGSNMA YQVGRYHTAR GADATLRLIN KILSDDLSTR QVADIVKGRA SAQESTKPAG       300
     RQRYAQRLEI KLDGVSVGDL KSYGDDRIEL RLKGLTREKR DDILRQIEKM LK               352
//

If you have problems or comments...

PBIL Back to PBIL home page