(data stored in SCRATCH zone)

EMBL: CP000271.PE20

CP000271.PE20        Location/Qualifiers
FT   CDS             21800..22342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B3009"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B3009"
FT                   /db_xref="EnsemblGenomes-Tr:ABE32988"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SF1"
FT                   /protein_id="ABE32988.1"
FT                   /translation="MISAHAKDSFDRIFRKAAQARLPLDAGDLCEIAPIADAGIGVSRD
FT                   TQVVVLTISSIVFRLLLILHFDEDGSTRAYYLKDAADERPFQEVFLEICNLCCGAMNQE
FT                   LLRYFPDLGMSTPYVLNARCLPHLHELKPGLLSSYSVTLNGTVRLAATVCVCADAPLDF
FT                   VADTSALEETGGELELF"
     MISAHAKDSF DRIFRKAAQA RLPLDAGDLC EIAPIADAGI GVSRDTQVVV LTISSIVFRL        60
     LLILHFDEDG STRAYYLKDA ADERPFQEVF LEICNLCCGA MNQELLRYFP DLGMSTPYVL       120
     NARCLPHLHE LKPGLLSSYS VTLNGTVRLA ATVCVCADAP LDFVADTSAL EETGGELELF       180
//

If you have problems or comments...

PBIL Back to PBIL home page