(data stored in ACNUC7421 zone)

EMBL: CP000271.PE203

CP000271.PE203       Location/Qualifiers
FT   CDS             239890..241107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2824"
FT                   /product="HI0933-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2824"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33171"
FT                   /db_xref="InterPro:IPR004792"
FT                   /db_xref="InterPro:IPR023166"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RW8"
FT                   /protein_id="ABE33171.1"
FT                   /translation="MESFDIAVIGAGAAGMMCAAVAGQLGRRVVLIDHSQRLAEKIRIS
FT                   GGGRCNFTNLYAGPANYLSANPHFCRSALARYTPRDFMALLKRHHVTWHEKHKGQLFCD
FT                   QSSDAVINVLKSECDAGRVAWRTPLSVEQVRQDAAGRFALDTRSGPITARALVIATGGL
FT                   SIPKIGATDFAYRLARQFGHKLIDTRPALVPLTFAAADWEPFSALSGVSLEVQLATGNK
FT                   KTGAEFNEDLLLTHRGLSGPGVLQISSYWQPGEPIHINLLPEQDATTALLEAKTGTKRQ
FT                   IGNLLSEWVPQRLAHVWLEAHQVPAEARVADLPDKTLRRVGEALSRWTLTPNGTEGYRK
FT                   AEVTRGGVDTRELSSSTMMSARAPGLYFIGEAVDVTGWLGGYNFQWAWASGVAAGQAAA
FT                   EYVQGA"
     MESFDIAVIG AGAAGMMCAA VAGQLGRRVV LIDHSQRLAE KIRISGGGRC NFTNLYAGPA        60
     NYLSANPHFC RSALARYTPR DFMALLKRHH VTWHEKHKGQ LFCDQSSDAV INVLKSECDA       120
     GRVAWRTPLS VEQVRQDAAG RFALDTRSGP ITARALVIAT GGLSIPKIGA TDFAYRLARQ       180
     FGHKLIDTRP ALVPLTFAAA DWEPFSALSG VSLEVQLATG NKKTGAEFNE DLLLTHRGLS       240
     GPGVLQISSY WQPGEPIHIN LLPEQDATTA LLEAKTGTKR QIGNLLSEWV PQRLAHVWLE       300
     AHQVPAEARV ADLPDKTLRR VGEALSRWTL TPNGTEGYRK AEVTRGGVDT RELSSSTMMS       360
     ARAPGLYFIG EAVDVTGWLG GYNFQWAWAS GVAAGQAAAE YVQGA                       405
//

If you have problems or comments...

PBIL Back to PBIL home page