(data stored in ACNUC7421 zone)

EMBL: CP000271.PE204

CP000271.PE204       Location/Qualifiers
FT   CDS             241176..241388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2823"
FT                   /product="SSU ribosomal protein S21P"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2823"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33172"
FT                   /db_xref="GOA:Q13RW7"
FT                   /db_xref="InterPro:IPR001911"
FT                   /db_xref="InterPro:IPR038380"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13RW7"
FT                   /protein_id="ABE33172.1"
FT                   /translation="MTTIRVKDNEPFEVAMRRFKRTMEKTGLLTELRAREFYEKPTAER
FT                   KRKKAAAVKRHFKRLRGQMLPKKFY"
     MTTIRVKDNE PFEVAMRRFK RTMEKTGLLT ELRAREFYEK PTAERKRKKA AAVKRHFKRL        60
     RGQMLPKKFY                                                               70
//

If you have problems or comments...

PBIL Back to PBIL home page